PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa003369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 167aa    MW: 19395.7 Da    PI: 9.7325
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58675749PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-12016PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45e-181468357
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               ++ ++t+eq++ Le+ F+ n++++ +++ +LA++lg++ rq+ +W+qN+Ra++++
  Lsa003369 14 NKKRLTNEQVKLLETSFNFNNKLDSTRKSQLAQELGVPARQIAIWYQNKRARWRN 68
               56789************************************************95 PP

2HD-ZIP_I/II101.86.1e-3314105293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +k+rl++eqvklLE+sF+ ++kL+++rK++la+eLg+ +rq+a+W+qn+RAR++++ lE+++++L++++++++++++rLe+eve+L+ el++
    Lsa003369  14 NKKRLTNEQVKLLETSFNFNNKLDSTRKSQLAQELGVPARQIAIWYQNKRARWRNQSLETEHKTLQQRLERVSSDKNRLEREVERLKGELEK 105
                  79*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-17570IPR009057Homeodomain-like
PROSITE profilePS5007116.374969IPR001356Homeobox domain
SMARTSM003892.2E-151173IPR001356Homeobox domain
CDDcd000861.80E-131270No hitNo description
PfamPF000462.9E-151468IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-181969IPR009057Homeodomain-like
PRINTSPR000312.2E-54049IPR000047Helix-turn-helix motif
PROSITE patternPS0002704467IPR017970Homeobox, conserved site
PRINTSPR000312.2E-54965IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MDFSQPKKHP QKANKKRLTN EQVKLLETSF NFNNKLDSTR KSQLAQELGV PARQIAIWYQ  60
NKRARWRNQS LETEHKTLQQ RLERVSSDKN RLEREVERLK GELEKAKDLL VSSKSMNYAS  120
LPSFSSSCDD VGSSSLLGDH GDFYVCFDDH QFDHKSNGHD FFARTMS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1616KKHPQKANKKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273463.18e-57PREDICTED: homeobox-leucine zipper protein ATHB-52
TrEMBLA0A124SDH61e-111A0A124SDH6_CYNCS; Helix-turn-helix motif-containing protein
STRINGVIT_10s0003g00380.t012e-56(Vitis vinifera)